PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S16439.10
Common NameJCGZ_00438, LOC105648111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 355aa    MW: 40467.7 Da    PI: 7.837
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S16439.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.6e-3263116255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    prlrWtpeLH +Fv+ave+LGG+++AtPk +l+lm+v+gL+++hvkSHLQ+YR+
  Jcr4S16439.10  63 PRLRWTPELHLCFVKAVERLGGQDRATPKLVLQLMNVNGLSIAHVKSHLQMYRS 116
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-3159117IPR009057Homeodomain-like
PROSITE profilePS5129414.68359119IPR017930Myb domain
SuperFamilySSF466892.87E-1561117IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-2363118IPR006447Myb domain, plants
PfamPF002496.8E-1064115IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MQGSEQTGCS KTRASRQNEE ESESGENDED ESRPKNGASS SNSTVEESEK KPSVRPYVRS  60
KMPRLRWTPE LHLCFVKAVE RLGGQDRATP KLVLQLMNVN GLSIAHVKSH LQMYRSKKID  120
DPSQAMSDHR HLVESGDRNI YNLSQLPMLQ GYNQHYGSNY RYGDASWNAR ESFVYNPHMG  180
RCLVDENRQG LYGTVAERIF GANNNCNNIN NHHSNCSSHC NFQSQNQKMW QTQSSSSFIT  240
DNRLLQAKLE EKSTPYDTRR HVVSDMXXXX QEFKTTFKRK AADCNLDLDL SLKLTPVDGS  300
RQSMEESEVD SELSLSLYSP SSSKLSRLKR GDQNDNNINN KEYYAKRAST LDLTI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012089799.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A067JG080.0A0A067JG08_JATCU; Uncharacterized protein
STRINGPOPTR_0016s12940.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-65G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]